DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or74a and Or65c

DIOPT Version :9

Sequence 1:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster


Alignment Length:296 Identity:55/296 - (18%)
Similarity:109/296 - (36%) Gaps:87/296 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 YLLALLNFFLVPVTNVIYHRREML-----------YKQVYPFDNTQLHFFIPLLVLNF--WVGFI 196
            :|:.|..|.|:.:|:.::..:::|           .|.::|..:..::.|....|:.|  |:..|
  Fly   157 WLVFLCIFILLLITSPLWVHQQILPLHAAFPFQWHEKSIHPISHAFIYLFQTWNVMYFLTWLVCI 221

  Fly   197 --ITSMLFGELNVMGEL----MMHLNAR---YIQLGQDLRRSAQMLLKKSSSLNVAIAYRLNLTH 252
              ::..::.|:....|:    :.||:.|   |.||..:..|..|              :...:.|
  Fly   222 EGLSVSIYVEITFAIEVLCLELRHLHQRCHGYEQLRLETNRLVQ--------------FHQKIVH 272

  Fly   253 ILRRNAALRDFGQRVEKEFTLRIF----VM------FAFSAGLLCALFFKAFTNPWGNVAYIVWF 307
            ||               :.|.::|    :|      |..|..:|.|:  :|..:|        ..
  Fly   273 IL---------------DHTNKVFHGTLIMQMGVNFFLVSLSVLEAM--EARKDP--------KV 312

  Fly   308 LAKF--MELLALGML------GSILLKTTDELGMMYYTADWEQVIHQSDNVGENVKLMKLVTLAI 364
            :|:|  :.|||||.|      |.:|.:.:..:....|.|        .|.:..:..:.:.:.|.|
  Fly   313 VAQFAVLMLLALGHLSMWSYFGDLLSQKSLTISEAAYEA--------YDPIKGSKDVYRDLCLII 369

  Fly   365 QLNSRPFFITGLNYFRVSLTAVLKIIQGAFSYFTFL 400
            :....|..:....:...:......|:...:...|||
  Fly   370 RRGQEPLIMRASPFPSFNFINYSAILNQCYGILTFL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 52/288 (18%)
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 52/288 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.