DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or74a and Or65b

DIOPT Version :9

Sequence 1:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster


Alignment Length:293 Identity:62/293 - (21%)
Similarity:112/293 - (38%) Gaps:82/293 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 IYHRREML---------YKQVYPFDNTQLHFFIPLLVLNFWVGFIITSMLFGELNVMGELMMHLN 216
            ||:.||.:         .:::.|: .::.|..:.:.::.|:     .||.||....||:      
  Fly    29 IYYWREQMKAMALFTTTEERLLPY-RSKWHTLVYIQMVIFF-----ASMSFGLTESMGD------ 81

  Fly   217 ARYIQLGQDLR--RSAQMLLKKSSSLNVAIAYRLNLTHILRRNAALRDFGQR----VEKEFTLRI 275
              ::|:|:||.  ..|..::.|:...   ..|...|..::....||..:.|:    ||.:...|.
  Fly    82 --HVQMGRDLAFILGAFFIIFKTYYF---CWYGDELDQVISDLDALHPWAQKGPNPVEYQTGKRW 141

  Fly   276 FVMFAFSAG-----LLCALFFKAFTNP-W---GNVAY-------------------IVWFLAKFM 312
            :.:.||...     .||.|.....|:| |   .|:.:                   |::....:.
  Fly   142 YFVMAFFLATSWSFFLCILLLLLITSPMWVHQQNLPFHAAFPFQWHEKSLHPISHAIIYLFQSYF 206

  Fly   313 ELLALGML----G-SILLKTTDELGMMYYTADWEQVIHQSDNVG------ENVKLMKLVTLAIQL 366
            .:..|..|    | ||.:......|:.....:..| ||: .|.|      |..:|:||....:::
  Fly   207 AVYCLTWLLCIEGLSICIYAEITFGIEVLCLELRQ-IHR-HNYGLQELRMETNRLVKLHQKIVEI 269

  Fly   367 NSRP---FFIT-----GLNYFRVSLTAVLKIIQ 391
            ..|.   |..|     |:|:..||| :||:.::
  Fly   270 LDRTNDVFHGTLIMQMGVNFSLVSL-SVLEAVE 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 62/293 (21%)
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 49/225 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465407
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.