DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or74a and Or1a

DIOPT Version :9

Sequence 1:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster


Alignment Length:361 Identity:78/361 - (21%)
Similarity:138/361 - (38%) Gaps:58/361 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 YLIANRQDM----DNMLTGLPTYLILVEMQIRCFQLAWHK--DRFRALLQRFYAEIYV-----SE 121
            :::.||..:    :.::.||.....|::|.|  |....|.  |..:.:...|..|..|     |:
  Fly    58 FMVQNRNQIVLCSEALMHGLQMVSSLLKMAI--FLAKSHDLVDLIQQIQSPFTEEDLVGTEWRSQ 120

  Fly   122 EMEPHLFASIQRQMLA-TRVNSTVYLLALLNFFLVPV--TNVIYHRREML-----YKQVYPFDNT 178
            .....|.|:|...|.| |.|          :|.|:||  |.:.||.....     ::.:.|:|.|
  Fly   121 NQRGQLMAAIYFMMCAGTSV----------SFLLMPVALTMLKYHSTGEFAPVSSFRVLLPYDVT 175

  Fly   179 QLHFF-IPLLVLNFWVGFIITSMLFGELNVMGELMMHLNARYIQLGQDLRRSAQMLLKKSSSLNV 242
            |.|.: :...::.|.:.|...|.. |...:.|...:.::.:|.:|||.|:|.........|.   
  Fly   176 QPHVYAMDCCLMVFVLSFFCCSTT-GVDTLYGWCALGVSLQYRRLGQQLKRIPSCFNPSRSD--- 236

  Fly   243 AIAYRLNLTHILRRNAALRDFGQRVEKEFTLRIFVMFAFSAGLLCAL---FFKAFTNPWGNVAYI 304
                 ..|:.|...:|.|....|.....|....||......||.|::   :....||.  |.|::
  Fly   237 -----FGLSGIFVEHARLLKIVQHFNYSFMEIAFVEVVIICGLYCSVICQYIMPHTNQ--NFAFL 294

  Fly   305 VWFLAKFMELLALGMLGS--ILLKTTDELGMMYYTADWEQVIHQSDNVGENVKLMKLVTLAIQLN 367
            .:|.......|.:.:.|:  :.|:......::|....|:.:         ..|..||....|:..
  Fly   295 GFFSLVVTTQLCIYLFGAEQVRLEAERFSRLLYEVIPWQNL---------PPKHRKLFLFPIERA 350

  Fly   368 SRPFFITGLNYFRVSLTAVLKIIQGAFSYFTFLNSM 403
            .|. .:.|..:|.:....::.|.:.|.|:.|.:|::
  Fly   351 QRE-TVLGAYFFELGRPLLVWIFRTAGSFTTLMNAL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 72/343 (21%)
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 70/329 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465729
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.