DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13725 and CG6497

DIOPT Version :9

Sequence 1:NP_648967.1 Gene:CG13725 / 39928 FlyBaseID:FBgn0036708 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001261980.1 Gene:CG6497 / 39924 FlyBaseID:FBgn0036704 Length:218 Species:Drosophila melanogaster


Alignment Length:169 Identity:43/169 - (25%)
Similarity:77/169 - (45%) Gaps:34/169 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DLFCWFETVEE-----ENIPLTVLMYIGGLKVAIILFLALWCWTREEAEKNQEGNMDMPISYVRK 101
            ||..|....|.     :.|.|.:|:.|..:. ||.:|:.|..:.|...:...|    |.:..::.
  Fly    46 DLMYWKRLAEVFSQDIDCIQLAILLLIFAIN-AIFVFIILSVYLRPALDNGSE----MSLLEIKD 105

  Fly   102 RYCRFLVMNLLASVDRLIHHHSHI---------DDFLQSRKDCGEAVEQFRWRARRLFERTDLQL 157
            ||.||:::.|:|.:||:   .|.|         ..::::..:..:||..||..||:|....:.::
  Fly   106 RYARFILLRLIARLDRI---QSKISAKRKSLTFQHYVRAHTNMVKAVAVFRKDARKLILPNESEI 167

  Fly   158 CVPLHEVLSVDDPQEKELLRLGYGDKLAQLRELDVYKMI 196
            .:|:.::..|.|.:|:.|.|.||            ||:|
  Fly   168 LMPIEDIYGVADDEERLLRRSGY------------YKLI 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13725NP_648967.1 DUF4736 35..199 CDD:292508 43/169 (25%)
CG6497NP_001261980.1 DUF4736 32..207 CDD:292508 43/169 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448214
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016592
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.