DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6512 and Bcs1l

DIOPT Version :9

Sequence 1:NP_730248.2 Gene:CG6512 / 39922 FlyBaseID:FBgn0036702 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001292581.1 Gene:Bcs1l / 66821 MGIID:1914071 Length:418 Species:Mus musculus


Alignment Length:306 Identity:75/306 - (24%)
Similarity:125/306 - (40%) Gaps:85/306 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 KWVRVRLQQNSNSGSGVLWFNIGSVDSFERNLEAAQTEQGT--ESINFVPV-----IYRNEVEAA 269
            ||:||  ::|                   |:::....:.||  ||:.|..:     ::.|.:|.|
Mouse   111 KWIRV--ERN-------------------RDMQMVDLQTGTPWESVTFTALGTDRKVFFNILEEA 154

  Fly   270 SLTGLLPTLLIIGFLVYMMRKSADMMGGGRGRKGGGLFGGVMQSTAKLTNPNEIGVGFKDVAGCE 334
            ....|...   .|..|......::....|..|:...|...|:|.          |:..:.|.   
Mouse   155 RALALQQE---EGKTVMYTAVGSEWRTFGYPRRRRPLDSVVLQQ----------GLADRIVK--- 203

  Fly   335 EAKIEIMEFVNFLKNPQQYIDLGAKIPKGAMLTGPPGTGKTLLAKATAGEA--NVPFITVSGSEF 397
                :|.||::   ||:.|||.|....:|.:|.||||.||:....|.|||.  ::..::::.|  
Mouse   204 ----DIREFID---NPKWYIDRGIPYRRGYLLYGPPGCGKSSFITALAGELEHSICLLSLTDS-- 259

  Fly   398 LEMFVGVGPSRVRDMFAMARKHAPCILFIDEIDAVGRKR-------------GGKTFGGHSEQEN 449
                 .:...|:..:.::|.:.:  ::.::::||....|             |..||.|      
Mouse   260 -----SLSDDRLNHLLSVAPQQS--LVLLEDVDAAFLSRDLAVENPIKYQGLGRLTFSG------ 311

  Fly   450 TLNQLLVEMDGFNTTTNVVVLAATNRVDILDKALMRPGRFDRQIYV 495
                ||..:||..:|...:|...||.:|.||.||:||||.|.:.||
Mouse   312 ----LLNALDGVASTEARIVFMTTNYIDRLDPALIRPGRVDLKEYV 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6512NP_730248.2 FtsH_ext 163..259 CDD:284011 11/48 (23%)
FtsH_fam 271..764 CDD:273520 61/240 (25%)
AAA 365..496 CDD:278434 41/146 (28%)
Peptidase_M41 580..762 CDD:279742
Bcs1lNP_001292581.1 BCS1_N 24..191 CDD:214980 20/103 (19%)
AAA 223..354 CDD:214640 42/150 (28%)
AAA 226..355 CDD:278434 41/147 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.