DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6512 and BCS1L

DIOPT Version :9

Sequence 1:NP_730248.2 Gene:CG6512 / 39922 FlyBaseID:FBgn0036702 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001073335.1 Gene:BCS1L / 617 HGNCID:1020 Length:419 Species:Homo sapiens


Alignment Length:335 Identity:80/335 - (23%)
Similarity:126/335 - (37%) Gaps:98/335 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 SYL---SKGVVEKLEVV----------NKKWVRVRLQQNSNSGSGVLWFNIGSVDSFERNLEAAQ 247
            |||   |..:..|.|.|          ..||:||..                     .|.::...
Human    82 SYLQHESGRISTKFEFVPSPGNHFIWYRGKWIRVER---------------------SREMQMID 125

  Fly   248 TEQGT--ESINFVPV-----IYRNEVEAASLTGLLPTLLIIGFLVYMMRKSADMMGGGRGRKGGG 305
            .:.||  ||:.|..:     ::.|.:|.|....|...   .|..|......::....|..|:...
Human   126 LQTGTPWESVTFTALGTDRKVFFNILEEARELALQQE---EGKTVMYTAVGSEWRPFGYPRRRRP 187

  Fly   306 LFGGVMQSTAKLTNPNEIGVGFKDVAGCEEAKIEIMEFVNFLKNPQQYIDLGAKIPKGAMLTGPP 370
            |...|:|.          |:..:.|...:|          |:.||:.|.|.|....:|.:|.|||
Human   188 LNSVVLQQ----------GLADRIVRDVQE----------FIDNPKWYTDRGIPYRRGYLLYGPP 232

  Fly   371 GTGKTLLAKATAGEA--NVPFITVSGSEFLEMFVGVGPSRVRDMFAMARKHAPCILFIDEIDAVG 433
            |.||:....|.|||.  ::..::::.|       .:...|:..:.::|.:.:  ::.::::||..
Human   233 GCGKSSFITALAGELEHSICLLSLTDS-------SLSDDRLNHLLSVAPQQS--LVLLEDVDAAF 288

  Fly   434 RKR-------------GGKTFGGHSEQENTLNQLLVEMDGFNTTTNVVVLAATNRVDILDKALMR 485
            ..|             |..||.|          ||..:||..:|...:|...||.||.||.||:|
Human   289 LSRDLAVENPVKYQGLGRLTFSG----------LLNALDGVASTEARIVFMTTNHVDRLDPALIR 343

  Fly   486 PGRFDRQIYV 495
            |||.|.:.||
Human   344 PGRVDLKEYV 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6512NP_730248.2 FtsH_ext 163..259 CDD:284011 17/77 (22%)
FtsH_fam 271..764 CDD:273520 60/240 (25%)
AAA 365..496 CDD:278434 42/146 (29%)
Peptidase_M41 580..762 CDD:279742
BCS1LNP_001073335.1 BCS1_N 24..191 CDD:214980 26/132 (20%)
RecA-like_BCS1 201..353 CDD:410918 49/180 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.