DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6512 and Bcs1l

DIOPT Version :9

Sequence 1:NP_730248.2 Gene:CG6512 / 39922 FlyBaseID:FBgn0036702 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001007667.1 Gene:Bcs1l / 301514 RGDID:1359658 Length:418 Species:Rattus norvegicus


Alignment Length:295 Identity:75/295 - (25%)
Similarity:124/295 - (42%) Gaps:67/295 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 GSGVLWFNIGSVDSFERN--LEAAQTEQGT--ESINFVPV-----IYRNEVEAASLTGLLPTLLI 280
            |:..:|:. |.....|||  ::....:.||  ||:.|..:     ::.|.:|.|....|...   
  Rat   102 GNHFIWYQ-GKWIRVERNREMQMVDLQTGTPWESVTFTALGTDRKVFFNILEEARALALQQE--- 162

  Fly   281 IGFLVYMMRKSADMMGGGRGRKGGGLFGGVMQSTAKLTNPNEIGVGFKDVAGCEEAKIEIMEFVN 345
            .|..|......::....|..|:...|...|:|.          |:..:.|.       :|.||::
  Rat   163 EGKTVMYTAVGSEWRTFGYPRRRRPLDSVVLQQ----------GLADRIVK-------DIREFID 210

  Fly   346 FLKNPQQYIDLGAKIPKGAMLTGPPGTGKTLLAKATAGEA--NVPFITVSGSEFLEMFVGVGPSR 408
               ||:.|||.|....:|.:|.||||.||:....|.|||.  ::..::::.|       .:...|
  Rat   211 ---NPKWYIDRGIPYRRGYLLYGPPGCGKSSFITALAGELEHSICLLSLTDS-------SLSDDR 265

  Fly   409 VRDMFAMARKHAPCILFIDEIDAVGRKR-------------GGKTFGGHSEQENTLNQLLVEMDG 460
            :..:.::|.:.:  ::.::::||....|             |..||.|          ||..:||
  Rat   266 LNHLLSVAPQQS--LVLLEDVDAAFLSRDLAVENPVKYQGLGRLTFSG----------LLNALDG 318

  Fly   461 FNTTTNVVVLAATNRVDILDKALMRPGRFDRQIYV 495
            ..:|...:|...||.:|.||.||:||||.|.:.||
  Rat   319 VASTEARIVFMTTNHIDRLDPALIRPGRVDLKEYV 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6512NP_730248.2 FtsH_ext 163..259 CDD:284011 11/37 (30%)
FtsH_fam 271..764 CDD:273520 61/240 (25%)
AAA 365..496 CDD:278434 41/146 (28%)
Peptidase_M41 580..762 CDD:279742
Bcs1lNP_001007667.1 BCS1_N 24..191 CDD:214980 20/92 (22%)
RecA-like_BCS1 201..353 CDD:410918 50/180 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.