DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and RBP1

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001320402.1 Gene:RBP1 / 842216 AraportID:AT1G58470 Length:360 Species:Arabidopsis thaliana


Alignment Length:243 Identity:97/243 - (39%)
Similarity:137/243 - (56%) Gaps:45/243 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGT 91
            |..|:|:||::.:||.|:|:.||.|||.:.||:|.|:..|.:.||||||.|::...|.|.| :.|
plant     4 DRYKLFVGGIAKETSEEALKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVVKAL-RDT 67

  Fly    92 HELDGKKVDPKVA--------------FPRRAHPKM------------VTRTKKIFVGGLSAPTT 130
            |.:.||.||.:.|              |..|...:|            .:|||||||||||:.||
plant    68 HFILGKPVDVRKAIRKHELYQQPFSMQFLERKVQQMNGGLREMSSNGVTSRTKKIFVGGLSSNTT 132

  Fly   131 LEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQP 195
            .|:.|||||:||...|.::|.|..|||.|||||||:.|||.|:.|.:.:|||:::|.||.|:|.|
plant   133 EEEFKSYFERFGRTTDVVVMHDGVTNRPRGFGFVTYDSEDSVEVVMQSNFHELSDKRVEVKRAIP 197

  Fly   196 KE---------VMLPANLAKTRAA----GRSAYGELV-----VWGSSH 225
            ||         |.:|.:.:..:|.    .::.||.::     |:|..|
plant   198 KEGIQSNNGNAVNIPPSYSSFQATPYVPEQNGYGMVLQFPPPVFGYHH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 34/87 (39%)
RRM2_MSI 119..192 CDD:240769 42/72 (58%)
RBP1NP_001320402.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 82 1.000 Domainoid score I2922
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565323at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.