DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and RBP47A

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001321909.1 Gene:RBP47A / 841384 AraportID:AT1G49600 Length:450 Species:Arabidopsis thaliana


Alignment Length:179 Identity:51/179 - (28%)
Similarity:76/179 - (42%) Gaps:40/179 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NDPG-KMFIGGLSWQTSPESLRDYF-GRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLT 88
            |.|. .:|:|.|:...|...|.:.| |||..:..|.|:.|..|.||:|:|||.|.|.|...:.:|
plant   209 NGPDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDSNTGRSKGYGFVRFGDENERSRAMT 273

  Fly    89 QGTHELDG-----KKVDPKVAFPRRA--------------------HPKM---VTRTKKIFVGGL 125
                |::|     :::...:|.|:||                    :..|   .:....||||||
plant   274 ----EMNGAFCSSRQMRVGIATPKRAAAYGQQNGSQALTLAGGHGGNGSMSDGESNNSTIFVGGL 334

  Fly   126 SAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDK 174
            .|..|.||:...|..||.:....:...|      |.|||.|.:....::
plant   335 DADVTEEDLMQPFSDFGEVVSVKIPVGK------GCGFVQFANRQSAEE 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 25/80 (31%)
RRM2_MSI 119..192 CDD:240769 19/56 (34%)
RBP47ANP_001321909.1 RRM1_SECp43_like 120..200 CDD:409780
RRM2_SECp43_like 212..291 CDD:409781 25/82 (30%)
RRM_SF 326..397 CDD:473069 19/58 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.