DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and RBP47C'

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_175181.1 Gene:RBP47C' / 841159 AraportID:AT1G47500 Length:434 Species:Arabidopsis thaliana


Alignment Length:177 Identity:55/177 - (31%)
Similarity:81/177 - (45%) Gaps:37/177 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NDPG-KMFIGGLSWQTSPESLRDYFG-RYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLT 88
            |.|. .:|:|.|:...|...|.:.|. :|..:..|.|:.|..|.||:|:|||.|.|.|...|.:|
plant   195 NGPDLSIFVGDLAPDVSDALLHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAMT 259

  Fly    89 QGTHELDGKKVDPKV-----AFPRRAH---------PK-MVTRTK------KIFVGGLSAPTTLE 132
                |::|.|...:.     |.||:.:         |. ..||::      .||||||.:..|.|
plant   260 ----EMNGVKCSSRAMRIGPATPRKTNGYQQQGGYMPSGAFTRSEGDTINTTIFVGGLDSSVTDE 320

  Fly   133 DVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTF----QSEDVVDKV 175
            |:|..|.:||.|....:...|      |.|||.|    .:|:.::|:
plant   321 DLKQPFSEFGEIVSVKIPVGK------GCGFVQFVNRPNAEEALEKL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 25/80 (31%)
RRM2_MSI 119..192 CDD:240769 22/61 (36%)
RBP47C'NP_175181.1 RRM1_SECp43_like 104..186 CDD:409780
RRM2_SECp43_like 198..277 CDD:409781 25/82 (30%)
RRM3_NGR1_NAM8_like 305..376 CDD:409782 22/63 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.