DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and RBP47C

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_175180.1 Gene:RBP47C / 841157 AraportID:AT1G47490 Length:432 Species:Arabidopsis thaliana


Alignment Length:177 Identity:54/177 - (30%)
Similarity:78/177 - (44%) Gaps:37/177 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NDPG-KMFIGGLSWQTSPESLRDYFG-RYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLT 88
            |.|. .:|:|.||...|...|.:.|. :|..:..|.|:.|..|.||:|:|||.|.|.|...|.:|
plant   193 NGPDLSIFVGDLSPDVSDNLLHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAMT 257

  Fly    89 QGTHELDGKKVDPKV-----AFPRRAH----------------PKMVTRTKKIFVGGLSAPTTLE 132
                |::|.|...:.     |.||:.:                |:.......||||||.:..|.|
plant   258 ----EMNGVKCSSRAMRIGPATPRKTNGYQQQGGYMPNGTLTRPEGDIMNTTIFVGGLDSSVTDE 318

  Fly   133 DVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTF----QSEDVVDKV 175
            |:|..|.:||.|....:...|      |.|||.|    .:|:.::|:
plant   319 DLKQPFNEFGEIVSVKIPVGK------GCGFVQFVNRPNAEEALEKL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 26/80 (33%)
RRM2_MSI 119..192 CDD:240769 22/61 (36%)
RBP47CNP_175180.1 RRM1_SECp43_like 102..184 CDD:409780
RRM2_SECp43_like 196..275 CDD:409781 26/82 (32%)
RRM3_NGR1_NAM8_like 303..374 CDD:409782 22/63 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.