DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and AT1G17640

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001319031.1 Gene:AT1G17640 / 838341 AraportID:AT1G17640 Length:369 Species:Arabidopsis thaliana


Alignment Length:193 Identity:83/193 - (43%)
Similarity:125/193 - (64%) Gaps:9/193 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQG 90
            :.|||:|:||:||:|:.|:..:|||::|::.::::|.|..|...||||||||:|....:|||.: 
plant    63 SSPGKLFVGGVSWETTAETFANYFGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLEE- 126

  Fly    91 THELDGKKVDPKVAFPR---RAHPKMVTRTKKIFVGGLSAPTTLE--DVKSYFEQFGPIEDAMLM 150
            .|.:|.:|||.|...||   ....|.|::|:|||||||  |..||  ::|:||..:|.|.:..:|
plant   127 DHVIDDRKVDLKRTLPRGDKDTDIKAVSKTRKIFVGGL--PPLLEEDELKNYFCVYGDIIEHQIM 189

  Fly   151 FDKQTNRHRGFGFVTFQSEDVVDKV-CEIHFHEINNKMVECKKAQPKEVMLPANLAKTRAAGR 212
            :|..|.|.|||||||||:||.||:: .:...||:.:|.||.|:|:||......:.....|:|:
plant   190 YDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKRAEPKRTGRDNSFRSYGASGK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 32/73 (44%)
RRM2_MSI 119..192 CDD:240769 37/75 (49%)
AT1G17640NP_001319031.1 RRM_SF 68..138 CDD:418427 31/70 (44%)
RRM_SF 158..236 CDD:418427 39/79 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565323at2759
OrthoFinder 1 1.000 - - FOG0000417
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.