DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and SR45a

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_563787.2 Gene:SR45a / 837246 AraportID:AT1G07350 Length:382 Species:Arabidopsis thaliana


Alignment Length:103 Identity:28/103 - (27%)
Similarity:51/103 - (49%) Gaps:5/103 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKV 86
            |:..|....:::.|||.:.:...|.|:|.:.|.:::..::.||.||.||||||::.......::.
plant    68 SDAENPGNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRC 132

  Fly    87 LTQGTHE-LDGKKVDPKVAFPRRAHPKMVTRTKKIFVG 123
            :....|. |.|:.:..:.|..||..    |.|...::|
plant   133 IRSLDHSVLQGRVITVEKARRRRGR----TPTPGKYLG 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 20/75 (27%)
RRM2_MSI 119..192 CDD:240769 1/5 (20%)
SR45aNP_563787.2 RRM 74..151 CDD:440488 20/76 (26%)

Return to query results.
Submit another query.