DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and AT5G55550

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001331843.1 Gene:AT5G55550 / 835649 AraportID:AT5G55550 Length:507 Species:Arabidopsis thaliana


Alignment Length:254 Identity:96/254 - (37%)
Similarity:133/254 - (52%) Gaps:65/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQG 90
            :|.||:||||:||.|..|.|||||..|||:.||::|:|..|.|:|||||:.|:||...::|: ..
plant     3 SDLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-MD 66

  Fly    91 THELDGK-----------------------------------------------KVDPKVAFPR- 107
            .|.:||:                                               :|:.|.|.|| 
plant    67 KHIIDGRTVCDFNHFSIFQQNKQSSDLIATSSICVFESSLNLCFSKCKDQIYVLQVEAKKAVPRD 131

  Fly   108 -----RAHPKMV----------TRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNR 157
                 :.|...:          .||||||||||.:..|.|:.|:||:|||.|.|.::|:|..|.|
plant   132 DQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQR 196

  Fly   158 HRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLPANLAKTRAAGRSAYG 216
            .|||||:||.|:|.||:|....|||:|.|:||.|:|.|||:...:|:....|:|.: ||
plant   197 PRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKEISPVSNIRSPLASGVN-YG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 36/120 (30%)
RRM2_MSI 119..192 CDD:240769 40/72 (56%)
AT5G55550NP_001331843.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 82 1.000 Domainoid score I2908
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565323at2759
OrthoFinder 1 1.000 - - FOG0000417
OrthoInspector 1 1.000 - - mtm1160
orthoMCL 1 0.900 - - OOG6_101082
Panther 1 1.100 - - O PTHR48032
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X310
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.