DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and AT5G54580

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_200269.1 Gene:AT5G54580 / 835546 AraportID:AT5G54580 Length:156 Species:Arabidopsis thaliana


Alignment Length:102 Identity:34/102 - (33%)
Similarity:54/102 - (52%) Gaps:9/102 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LGPCSPSEVPNDP-----GKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFV 75
            |.|.:.|:.|..|     ..:|:.|||.:|:.|.||..|.::|::::|.|:.|..:..|:|||||
plant    38 LSPQAESQTPARPQAEPSTNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFV 102

  Fly    76 TFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRRAHPK 112
            .::......|    |...:|||.:|..|.|...|.|:
plant   103 RYATLEDSAK----GIAGMDGKFLDGWVIFAEYARPR 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 26/74 (35%)
RRM2_MSI 119..192 CDD:240769
AT5G54580NP_200269.1 RRM 55..138 CDD:440488 29/85 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.