DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and AT5G47620

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001190485.1 Gene:AT5G47620 / 834812 AraportID:AT5G47620 Length:453 Species:Arabidopsis thaliana


Alignment Length:229 Identity:93/229 - (40%)
Similarity:128/229 - (55%) Gaps:43/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHEL 94
            |:||||:||:||.:.|||||..:|::.||::|||..|.|:||||||.|:|||..::|:.. .|.:
plant     7 KLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHII 70

  Fly    95 DGK----------------------KVDPKVAFPRRAH---------------PKMVTRTKKIFV 122
            |||                      .|:.|.|.||..|               |   :.:|||||
plant    71 DGKILVDSIVYNQLCRSDKCISLSEVVEAKKAVPRDDHVVFNKSNSSLQGSPGP---SNSKKIFV 132

  Fly   123 GGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKM 187
            |||::..|..:.|.||.|||.|.|.::|:|.:|.|.|||||:::.||:.||||.:..|||:|.||
plant   133 GGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKM 197

  Fly   188 VECKKAQPKEVMLPA--NLAKTRAAGRSAYGELV 219
            ||.|.|.||::.|..  |.....:.|.|....|:
plant   198 VEVKLAVPKDMALNTMRNQMNVNSFGTSRISSLL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 38/95 (40%)
RRM2_MSI 119..192 CDD:240769 39/72 (54%)
AT5G47620NP_001190485.1 RRM_SF 8..73 CDD:302621 34/65 (52%)
RRM2_DAZAP1 126..205 CDD:240773 42/78 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 82 1.000 Domainoid score I2908
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565323at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1160
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48032
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X310
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.