DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and AT5G40490

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_198865.1 Gene:AT5G40490 / 834047 AraportID:AT5G40490 Length:423 Species:Arabidopsis thaliana


Alignment Length:226 Identity:86/226 - (38%)
Similarity:135/226 - (59%) Gaps:13/226 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IEQQQQQQQVELGPCSPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRS 69
            ||....:.|    |.|...| :..||:|:|||:.:|:......:||:||:|:::::|||..|.:.
plant    23 IEDDDDKSQ----PHSGGGV-DSAGKIFVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTGQP 82

  Fly    70 RGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRRAHPKMVTRTKKIFVGGLSAPTTLEDV 134
            |||||||::|.:.||||: |..|.:.||:|:.|...||.:......:||||||||:.:....::.
plant    83 RGFGFVTYADSSVVDKVI-QDNHIIIGKQVEIKRTIPRGSMSSNDFKTKKIFVGGIPSSVDDDEF 146

  Fly   135 KSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDK-VCEIHFHEINNKMVECKKAQPKE- 197
            |.:|.|||.:::..:|.|..|.|.|||||||::|||:||. :.:.:..|::...||.|||:||: 
plant   147 KEFFMQFGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPKKP 211

  Fly   198 --VMLPA-NLAKTRAAGRSAYGELVVWGSSH 225
              |..|: ....:|:.....||:  .:|..|
plant   212 NSVTTPSKRFGDSRSNFGGGYGD--GYGGGH 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 32/73 (44%)
RRM2_MSI 119..192 CDD:240769 30/73 (41%)
AT5G40490NP_198865.1 RRM_SF 44..114 CDD:302621 31/70 (44%)
RRM_SF 131..206 CDD:302621 31/74 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565323at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.