DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and CCR1

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_195637.1 Gene:CCR1 / 830082 AraportID:AT4G39260 Length:169 Species:Arabidopsis thaliana


Alignment Length:74 Identity:29/74 - (39%)
Similarity:49/74 - (66%) Gaps:4/74 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHEL 94
            :.|:|||:|.|:.|.|:..|.::||:.::.::.|..:.||||||||||.|    :|.:.....|:
plant     7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEM 67

  Fly    95 DGKKVDPKV 103
            :||::|.:|
plant    68 NGKELDGRV 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 29/74 (39%)
RRM2_MSI 119..192 CDD:240769
CCR1NP_195637.1 RRM2_NsCP33_like 7..82 CDD:410187 29/74 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.