DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and AT4G26650

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_567753.1 Gene:AT4G26650 / 828772 AraportID:AT4G26650 Length:455 Species:Arabidopsis thaliana


Alignment Length:243 Identity:100/243 - (41%)
Similarity:143/243 - (58%) Gaps:42/243 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVL 87
            |..:|.||:||||:||.|..|.|::|||:|||:.||::|:|.||.|:|||||:.|:||:..::|:
plant     9 ESASDLGKLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVI 73

  Fly    88 TQGTHELDGKKVDPKVAFP--------RRAHPKMV-----------TRTKKIFVGGLSAPTTLED 133
             ...|.:||:.|:.|.|.|        |.|.|..:           .||||||||||.:..|..:
plant    74 -MDKHIIDGRTVEAKKAVPRDDQQVLKRHASPMHLISPSHGGNGGGARTKKIFVGGLPSSITEAE 137

  Fly   134 VKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEV 198
            .|:||:|||.|.|.::|:|..|.|.|||||:||.||:.||.|....|||:|.||||.|:|.|||:
plant   138 FKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRAVPKEL 202

  Fly   199 MLPANLAKTRAAGRSAYGELVVWGSSHAHSTAATSAAAAGLLPSSLAA 246
                   .:....||   .|:.:|:::            |::|:..:|
plant   203 -------SSTTPNRS---PLIGYGNNY------------GVVPNRSSA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 36/73 (49%)
RRM2_MSI 119..192 CDD:240769 40/72 (56%)
AT4G26650NP_567753.1 RRM1_hnRNPA_hnRNPD_like 17..87 CDD:240771 35/70 (50%)
RRM2_DAZAP1 120..199 CDD:240773 45/78 (58%)
RRM <121..280 CDD:223796 54/130 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 82 1.000 Domainoid score I2908
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565323at2759
OrthoFinder 1 1.000 - - FOG0000417
OrthoInspector 1 1.000 - - mtm1160
orthoMCL 1 0.900 - - OOG6_101082
Panther 1 1.100 - - O PTHR48032
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X310
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.