DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and RBP47B

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_188544.1 Gene:RBP47B / 821447 AraportID:AT3G19130 Length:435 Species:Arabidopsis thaliana


Alignment Length:244 Identity:59/244 - (24%)
Similarity:105/244 - (43%) Gaps:31/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QQQQQQQVELGPCSPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRG 71
            |.||.:.::.|.      .:|...:::|.|........|...|...|::|...|:::..|.:|.|
plant    92 QHQQHKAIDRGS------GDDVKTLWVGDLLHWMDETYLHSCFSHTGEVSSVKVIRNKLTSQSEG 150

  Fly    72 FGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRRAHPKMVTRTKK----------IFVGGLS 126
            :|||.|....:.::||    ....| .|.|....|.|.:....:..:|          :|||.||
plant   151 YGFVEFLSRAAAEEVL----QNYSG-SVMPNSDQPFRINWASFSTGEKRAVENGPDLSVFVGDLS 210

  Fly   127 APTTLEDV---KSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDK-VCEIHFHEINNKM 187
            ...|  ||   :::.:::..::.|.::.|..|.|.:|:|||.|..|:...: :.|::....:|:.
plant   211 PDVT--DVLLHETFSDRYPSVKSAKVVIDSNTGRSKGYGFVRFGDENERSRALTEMNGAYCSNRQ 273

  Fly   188 VECKKAQPKEVML----PANLAKTRAAGRSAYGELVVWGSSHAHSTAAT 232
            :....|.||..:.    .::.|...|.|..:.|.:.....|...||.||
plant   274 MRVGIATPKRAIANQQQHSSQAVILAGGHGSNGSMGYGSQSDGESTNAT 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 19/74 (26%)
RRM2_MSI 119..192 CDD:240769 21/86 (24%)
RBP47BNP_188544.1 RRM1_SECp43_like 109..189 CDD:409780 21/84 (25%)
RRM2_SECp43_like 201..280 CDD:409781 20/80 (25%)
RRM_SF 320..391 CDD:473069 2/3 (67%)

Return to query results.
Submit another query.