DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and AT3G13224

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_683559.2 Gene:AT3G13224 / 820515 AraportID:AT3G13224 Length:358 Species:Arabidopsis thaliana


Alignment Length:203 Identity:78/203 - (38%)
Similarity:131/203 - (64%) Gaps:7/203 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTH 92
            |||:|||||...|:......:||:||:|:::::|:|..|.:.|||||:||:||:.||||: :.||
plant    18 PGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVI-EDTH 81

  Fly    93 ELDGKKVDPKVAFPRRA--HPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQT 155
            .::||:|:.|...|:.|  :.....:||||||||:.:..|.:::|.:|.::|.:.:..::.|.:|
plant    82 VINGKQVEIKRTIPKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHET 146

  Fly   156 NRHRGFGFVTFQSEDVVDK-VCEIHFHEINNKMVECKKAQPKEVM--LPANLAKTRAAGRSAYGE 217
            ||.||||||.|.||:|||: :.:.:..::.:..||.|||:||:.:  .|.:.. :...|||:...
plant   147 NRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPKKSLNRSPPSYG-SHPRGRSSNDS 210

  Fly   218 LVVWGSSH 225
            ...:|..:
plant   211 YASYGGPY 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 33/73 (45%)
RRM2_MSI 119..192 CDD:240769 28/73 (38%)
AT3G13224NP_683559.2 RRM_SF 21..91 CDD:418427 32/70 (46%)
RRM_SF 110..188 CDD:418427 31/77 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 82 1.000 Domainoid score I2908
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565323at2759
OrthoFinder 1 1.000 - - FOG0000417
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.