DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and SLIRP

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_112487.1 Gene:SLIRP / 81892 HGNCID:20495 Length:109 Species:Homo sapiens


Alignment Length:102 Identity:30/102 - (29%)
Similarity:45/102 - (44%) Gaps:20/102 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 KKVDPKVAFPRRAHPKMVTRTKKIFVGGLSAPTTL--EDVKSYFEQFGPIEDAMLMFDKQTNRHR 159
            :.::..|||.||                  .|.|.  ..:|.:|.|||.:...:|.|||:|..||
Human    14 RSINQPVAFVRR------------------IPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHR 60

  Fly   160 GFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPK 196
            |.|:|.|.||:.:....:...|.|:...|:....:||
Human    61 GLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPK 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 1/7 (14%)
RRM2_MSI 119..192 CDD:240769 23/74 (31%)
SLIRPNP_112487.1 RRM_SLIRP 20..92 CDD:409688 28/89 (31%)

Return to query results.
Submit another query.