DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and AT2G35410

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_181084.1 Gene:AT2G35410 / 818107 AraportID:AT2G35410 Length:308 Species:Arabidopsis thaliana


Alignment Length:234 Identity:54/234 - (23%)
Similarity:96/234 - (41%) Gaps:46/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EQQQQQQQVELGPCSPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSR 70
            |:..|:::.|     .::..|...|:|:..|.|..|...:.:.||:.|.::...:::. ...::|
plant    77 EETSQEEKTE-----ETQNSNLKRKLFVFNLPWSMSVNDISELFGQCGTVNNVEIIRQ-KDGKNR 135

  Fly    71 GFGFVTFSDPN----SVDKVLTQGTHELDGKKVDPKVAFPRR------------AHPKMVTRTKK 119
            ||.|||.:...    ::||.   .|.::.|:.:  .|:|.||            ..|.......|
plant   136 GFAFVTMASGEEAQAAIDKF---DTFQVSGRII--SVSFARRFKKPTPKSPNDLPSPAPGDTRHK 195

  Fly   120 IFVGGLSAPTTLEDVKSYF--EQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHE 182
            ::|..|:.......::..|  ..|.|: .|.::|.....|..|:|||:|.:.:           |
plant   196 LYVSNLAWKARSTHLRELFTAADFNPV-SARVVFADPEGRSSGYGFVSFATRE-----------E 248

  Fly   183 INNKMVECKKAQPKEVM-LPANLA-KTRAAGRSAYGELV 219
            ..|.:.   |...||:| .|..|. ..|:|..|..|:.|
plant   249 AENAIT---KLNGKEIMGRPITLKFSLRSASESEDGDSV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 18/77 (23%)
RRM2_MSI 119..192 CDD:240769 16/74 (22%)
AT2G35410NP_181084.1 PABP-1234 97..>279 CDD:130689 46/202 (23%)
RRM_SF 97..168 CDD:409669 17/76 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.