DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and AT2G33410

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_180899.1 Gene:AT2G33410 / 817905 AraportID:AT2G33410 Length:404 Species:Arabidopsis thaliana


Alignment Length:207 Identity:90/207 - (43%)
Similarity:119/207 - (57%) Gaps:21/207 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQG 90
            :|.||:||||:||.|....||:||..:|::.:..||::..|.|.||||||.||||..:|:|| |.
plant     3 SDQGKLFIGGISWDTDENLLREYFSNFGEVLQVTVMREKATGRPRGFGFVAFSDPAVIDRVL-QD 66

  Fly    91 THELDGKKVDPKVAFPRRAHPK----------------MVTRTKKIFVGGLSAPTTLEDVKSYFE 139
            .|.:|.:.||.|.|..|.....                ...||||||||||....|.::.::|||
plant    67 KHHIDNRDVDVKRAMSREEQSPAGRSGTFNASRNFDSGANVRTKKIFVGGLPPALTSDEFRAYFE 131

  Fly   140 QFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLPANL 204
            .:||:.||::|.|:.|.|.||||||:|.|||.||.|....||::|.|.||.|:|.||:    ||.
plant   132 TYGPVSDAVIMIDQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRALPKD----ANP 192

  Fly   205 AKTRAAGRSAYG 216
            ......||.:.|
plant   193 GIASGGGRGSGG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 35/73 (48%)
RRM2_MSI 119..192 CDD:240769 38/72 (53%)
AT2G33410NP_180899.1 RRM_SF 8..78 CDD:418427 34/70 (49%)
RRM2_Hrp1p 111..188 CDD:409767 40/76 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 82 1.000 Domainoid score I2908
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565323at2759
OrthoFinder 1 1.000 - - FOG0000417
OrthoInspector 1 1.000 - - mtm1160
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X310
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.