DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and AT2G27330

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_565646.2 Gene:AT2G27330 / 817276 AraportID:AT2G27330 Length:116 Species:Arabidopsis thaliana


Alignment Length:73 Identity:24/73 - (32%)
Similarity:41/73 - (56%) Gaps:4/73 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 MFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELD 95
            :|:.|:|:.::.|:|...|.:||.:.:..|:.|....|.:||.:||||.....:|.|.    ||:
plant    23 LFVKGISFSSTEETLTQAFSQYGQVLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKALL----ELN 83

  Fly    96 GKKVDPKV 103
            .:.||.:|
plant    84 AQLVDGRV 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 24/73 (33%)
RRM2_MSI 119..192 CDD:240769
AT2G27330NP_565646.2 RRM_SF 23..99 CDD:473069 24/73 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.