DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and hnrnpab

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:XP_012814656.1 Gene:hnrnpab / 734098 XenbaseID:XB-GENE-6042555 Length:326 Species:Xenopus tropicalis


Alignment Length:230 Identity:93/230 - (40%)
Similarity:122/230 - (53%) Gaps:45/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QQQQQVELG----------PCSPSEVP-----------------NDPG-------------KMFI 33
            :|||.:|.|          ..:.|:||                 .|.|             |||:
 Frog     5 EQQQYMETGTENGHEACDAEAAESKVPGGQNGAEGDQINASKGEEDAGCVPDISSPLTEGVKMFV 69

  Fly    34 GGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKK 98
            |||||.||.:.|:|||.::|::|:..:..||.|.|||||||:.|.|..||||||.|..|.|||:.
 Frog    70 GGLSWDTSKKDLKDYFSKFGEVSDCTIKMDPNTGRSRGFGFILFKDAASVDKVLEQKEHRLDGRL 134

  Fly    99 VDPKVAFPRRAHPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGF 163
            :|||.|...:..|     .||||||||:.....:.::.|||.||.||...|..|.:||:.|||.|
 Frog   135 IDPKKAMAMKKDP-----IKKIFVGGLNPEAGEDKIREYFETFGEIEAIELPMDPKTNKRRGFVF 194

  Fly   164 VTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEV 198
            :||:.|:.|.|:.|..||.::....|.|.||||||
 Frog   195 ITFKEEEPVKKILEKKFHNVSGSKCEIKIAQPKEV 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 41/73 (56%)
RRM2_MSI 119..192 CDD:240769 31/72 (43%)
hnrnpabXP_012814656.1 CBFNT 1..52 CDD:311868 9/46 (20%)
RRM1_hnRNPAB 66..140 CDD:241201 42/73 (58%)
RRM2_hnRNPAB 145..224 CDD:241028 34/83 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.