DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and SRSF2

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_003007.2 Gene:SRSF2 / 6427 HGNCID:10783 Length:221 Species:Homo sapiens


Alignment Length:80 Identity:25/80 - (31%)
Similarity:43/80 - (53%) Gaps:3/80 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVL-TQGTHELDG 96
            :..|:::|||::||..|.:||.:.:..:.:|..|:.||||.||.|.|....:..: ......|||
Human    18 VDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDG 82

  Fly    97 KKVDPKVAFPRRAHP 111
            :::  :|...|...|
Human    83 REL--RVQMARYGRP 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 23/72 (32%)
RRM2_MSI 119..192 CDD:240769
SRSF2NP_003007.2 RRM_SRSF2_SRSF8 16..88 CDD:409751 22/71 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..221 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.