DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and RBM3

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens


Alignment Length:75 Identity:31/75 - (41%)
Similarity:51/75 - (68%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVL-TQ 89
            ::.||:|:|||::.|..::|.|:|..:|.|||.:|:||..|:|||||||:||::|......: ..
Human     3 SEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAM 67

  Fly    90 GTHELDGKKV 99
            ....|||:::
Human    68 NGESLDGRQI 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 30/71 (42%)
RRM2_MSI 119..192 CDD:240769
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 31/72 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.