DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and cirbp

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001017228.1 Gene:cirbp / 549982 XenbaseID:XB-GENE-492781 Length:166 Species:Xenopus tropicalis


Alignment Length:74 Identity:32/74 - (43%)
Similarity:54/74 - (72%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDP-NSVDKVLTQG 90
            |.||:|:|||:::|:.|||...|.:||.::|.:|:||..::||||||||||.:| ::.|.::...
 Frog     4 DEGKLFVGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMMAMN 68

  Fly    91 THELDGKKV 99
            ...:||:::
 Frog    69 GKSVDGRQI 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 30/71 (42%)
RRM2_MSI 119..192 CDD:240769
cirbpNP_001017228.1 RRM_CIRBP_RBM3 6..85 CDD:409883 31/72 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..166 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.