DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and Hnrnpdl

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_057899.2 Gene:Hnrnpdl / 50926 MGIID:1355299 Length:420 Species:Mus musculus


Alignment Length:213 Identity:93/213 - (43%)
Similarity:117/213 - (54%) Gaps:18/213 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KIEQQQQQQQVELGPCSPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRR 68
            ||...:.||              |.||||||||||.||.:.|.:|..|:|::.:..:..||.|.|
Mouse   137 KINASKNQQ--------------DDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGR 187

  Fly    69 SRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRRAHPKMVTRTKKIFVGGLSAPTTLED 133
            |||||||.|.|..||||||....|:||||.:|||    |....|.....||:||||||..|:.|.
Mouse   188 SRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPK----RAKALKGKEPPKKVFVGGLSPDTSEEQ 248

  Fly   134 VKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEV 198
            :|.||..||.||:..|..|.:||..|||.|:|:..|:.|.|:.|..:|:|.:...|.|.||||||
Mouse   249 IKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEV 313

  Fly   199 MLPANLAKTRAAGRSAYG 216
            .......:....|.:|.|
Mouse   314 YRQQQQQQKGGRGAAAGG 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 41/73 (56%)
RRM2_MSI 119..192 CDD:240769 32/72 (44%)
HnrnpdlNP_057899.2 RRM1_hnRPDL 149..224 CDD:241202 43/78 (55%)
RRM2_hnRPDL 234..308 CDD:241029 33/73 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565323at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.