DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and hnrnpdl

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001011015.1 Gene:hnrnpdl / 496424 XenbaseID:XB-GENE-495016 Length:297 Species:Xenopus tropicalis


Alignment Length:211 Identity:97/211 - (45%)
Similarity:116/211 - (54%) Gaps:19/211 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KIEQQQQQQQVELGPCSPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRR 68
            ||...:.||              |.||||||||||.||.:.|.:|..|:|::.:..:..||.|.|
 Frog    15 KINASKNQQ--------------DEGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGR 65

  Fly    69 SRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRRAHPKMVTRTKKIFVGGLSAPTTLED 133
            |||||||.|.|..||||||....|:||||.:|||    |....|.....||:||||||..||.|.
 Frog    66 SRGFGFVLFKDAVSVDKVLETKEHKLDGKLIDPK----RAKALKGKEPPKKVFVGGLSPETTEEQ 126

  Fly   134 VKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEV 198
            :|.||..||.||:..|..|.:||..|||.|||:..|:.|.|:.|..||:|.....|.|.||||||
 Frog   127 IKQYFGGFGEIENIELPMDTKTNERRGFCFVTYTGEEPVKKLLESRFHQIGTGKCEIKVAQPKEV 191

  Fly   199 MLPANLAKTRAAGRSA 214
            ..... .|.:..||.|
 Frog   192 YRQQQ-QKQQKGGRGA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 41/73 (56%)
RRM2_MSI 119..192 CDD:240769 35/72 (49%)
hnrnpdlNP_001011015.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 2/5 (40%)
RRM1_hnRPDL 27..102 CDD:410152 43/78 (55%)
RRM2_hnRPDL 112..186 CDD:409998 36/73 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..224 4/16 (25%)
Trnau1ap 222..>278 CDD:407550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565323at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.