DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and Rb97D

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster


Alignment Length:384 Identity:112/384 - (29%)
Similarity:151/384 - (39%) Gaps:94/384 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHEL 94
            |:|||||:..|:.|:|:.::|::|.:.:.:||:|..|:|||||||:|::....||:......|.:
  Fly    33 KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97

  Fly    95 DGKKVDPKVAFPRRAHPKMVTR-----TKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQ 154
            |||.|:.|.|.||   |:..:|     .||:|||||......|.::.||.|||.:....|:.||.
  Fly    98 DGKTVEAKRALPR---PERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKT 159

  Fly   155 TNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKA----QPKEVMLPANLAKTRAAGRSAY 215
            |.:.|||.||.|...|.|||......|.|....|:.||:    ..||...|..|           
  Fly   160 TGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIYNLDKKEKQQPGGL----------- 213

  Fly   216 GELVVWGSSHAHSTAATSAAAAGLLPSSLAAAASVLQQQQQQQQQQQQQQQQQQQHHQQLHHTHP 280
                                            |:.::....||||||...||....:.|.....|
  Fly   214 --------------------------------ANAIKPSLNQQQQQQGGGQQPPNGNMQAPSFRP 246

  Fly   281 QSPAHSHAHHPHTHSHSQLLGSLRYTPYPLPAHLSA------------AAVVVAQQQHHHQQQ-- 331
            ..|.            .|.:|.  |...|.||.:||            .|:....||...||.  
  Fly   247 PVPP------------QQAMGP--YQQQPPPAPMSAPPPNFNYWGPPPPAMPPYYQQPPPQQMNG 297

  Fly   332 -------QQQQQQQQQQQVVAAQQQHQQQQSLAQVV--AAAAGAAPGLLPLANPAPPAT 381
                   ||............|||.|..|......|  ....||.|.  |:.:..||.|
  Fly   298 WGPYPPPQQNGWNAPPPPPPGAQQWHANQWGCPPPVQQVPPVGAVPP--PMGHNGPPPT 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 30/73 (41%)
RRM2_MSI 119..192 CDD:240769 29/72 (40%)
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 32/76 (42%)
RRM2_hnRNPA_like 124..196 CDD:240774 29/71 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463952
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.