DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and sqd

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster


Alignment Length:200 Identity:82/200 - (41%)
Similarity:115/200 - (57%) Gaps:22/200 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQG 90
            :|..|:|:|||||:|:.:.|||:||:||:|....|..||.|.|||||.|:.|::..::|||....
  Fly    53 DDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAAD 117

  Fly    91 THELDGKKVDPKVAFPRRAHPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQT 155
            .|.::.||||||         |...|..|||||||:...:.|::|:||.|||.|.:..:.||||.
  Fly   118 EHIINSKKVDPK---------KAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQK 173

  Fly   156 NRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLPAN--LAKTRA-------AG 211
            ::.:||.|:||.||.||..:.:....:|..|.|:.|:|.||    |.|  :...|.       .|
  Fly   174 SQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPK----PENQMMGGMRGGPRGGMRGG 234

  Fly   212 RSAYG 216
            |..||
  Fly   235 RGGYG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 36/73 (49%)
RRM2_MSI 119..192 CDD:240769 31/72 (43%)
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 34/70 (49%)
RRM2_hnRNPD_like 137..211 CDD:240775 32/73 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463987
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4205
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I1542
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.