DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Rbp6 and SLIRP2

DIOPT Version :9

Sequence 1:	NP_001097631.1	Gene:	Rbp6 / 39919	FlyBaseID:	FBgn0260943	Length:	499	Species:	Drosophila melanogaster
Sequence 2:	NP_649808.1	Gene:	SLIRP2 / 41021	FlyBaseID:	FBgn0037602	Length:	91	Species:	Drosophila melanogaster

Alignment Length:	68	Identity:	26/68 - (38%)
Similarity:	39/68 - (57%)	Gaps:	0/68 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    30 KMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHEL 94
            |:|:|.|.|....:.||.||.:||.::.|.|:.|.....|:.:|||.||..::.:....|.||.|
  Fly    11 KLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSASNQNTHFL 75

  Fly    95 DGK 97
            ||:
  Fly    76 DGR 78

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Rbp6	NP_001097631.1	RRM1_MSI	31..105	CDD:241020	25/67 (37%)
Rbp6	NP_001097631.1	RRM2_MSI	119..192	CDD:240769
SLIRP2	NP_649808.1	RRM_SLIRP	11..83	CDD:240688	26/68 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45463981
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.840