Sequence 1: | NP_001097631.1 | Gene: | Rbp6 / 39919 | FlyBaseID: | FBgn0260943 | Length: | 499 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001315423.1 | Gene: | hnrnpdl / 406701 | ZFINID: | ZDB-GENE-040426-2717 | Length: | 296 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 92/198 - (46%) |
---|---|---|---|
Similarity: | 111/198 - (56%) | Gaps: | 15/198 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 QQVELGPCSPSEVP-----------NDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPT 65
Fly 66 TRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRRAHPKMVTRTKKIFVGGLSAPTT 130
Fly 131 LEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQP 195
Fly 196 KEV 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rbp6 | NP_001097631.1 | RRM1_MSI | 31..105 | CDD:241020 | 41/73 (56%) |
RRM2_MSI | 119..192 | CDD:240769 | 32/72 (44%) | ||
hnrnpdl | NP_001315423.1 | RRM1_hnRPDL | 31..106 | CDD:241202 | 43/78 (55%) |
RRM2_hnRPDL | 116..190 | CDD:241029 | 33/73 (45%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1565323at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |