DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and hnrnpdl

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001315423.1 Gene:hnrnpdl / 406701 ZFINID:ZDB-GENE-040426-2717 Length:296 Species:Danio rerio


Alignment Length:198 Identity:92/198 - (46%)
Similarity:111/198 - (56%) Gaps:15/198 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QQVELGPCSPSEVP-----------NDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPT 65
            |..|.|..|..|.|           .|.||||||||||.||.:.|.||..|:|::.:..:..||.
Zfish     2 QAEEQGDFSTDEFPEGSKINASKNQEDDGKMFIGGLSWDTSKKDLTDYLSRFGEVLDCTIKTDPL 66

  Fly    66 TRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRRAHPKMVTRTKKIFVGGLSAPTT 130
            |.||||||||.|.|..|||:||....|:||||.:|||    |....|.....||:||||||...|
Zfish    67 TGRSRGFGFVLFKDAESVDRVLELTEHKLDGKLIDPK----RAKAIKGKEPPKKVFVGGLSPDIT 127

  Fly   131 LEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQP 195
            .|.::.||..:|.||...|..|.:||..|||.||||..|:.|.|:.|..:|:|.:...|.|.|||
Zfish   128 EEQLREYFGVYGEIESIELPTDTKTNERRGFCFVTFALEEPVQKLLENRYHQIGSGKCEIKVAQP 192

  Fly   196 KEV 198
            |||
Zfish   193 KEV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 41/73 (56%)
RRM2_MSI 119..192 CDD:240769 32/72 (44%)
hnrnpdlNP_001315423.1 RRM1_hnRPDL 31..106 CDD:241202 43/78 (55%)
RRM2_hnRPDL 116..190 CDD:241029 33/73 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565323at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.