DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and CG3335

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster


Alignment Length:297 Identity:70/297 - (23%)
Similarity:111/297 - (37%) Gaps:71/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DIKIEQQQQQQQVELGPCSPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMK--DP 64
            |.|.:::..:.:      ...:.|.....:|:..|:::|..|::..:|...|.|....:.|  ||
  Fly   658 DAKPDEEDSRAE------DADDEPEPNTTLFLRNLNFKTVQETVEKHFRHLGSIHTVEIAKRRDP 716

  Fly    65 TTRR---SRGFGFVTFSDPNSVDKVL--TQGTHELDGKKVDPK------------VAFPRRAHPK 112
            ...|   |.|:||:.|...:..:..|  .|.|| :||..|:.|            .|..|.|..|
  Fly   717 ENPREFKSLGYGFIQFKKSSVAEHALKNLQLTH-IDGNPVELKRSDRVLKTQDNDGAQRRLASQK 780

  Fly   113 MVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQT--NRHRGFGFVTFQSEDVVDKV 175
            ..|.| ||.|..:.......:|:..|:.||.:....:.....|  :.|||||||.:.|:      
  Fly   781 KQTGT-KILVRNIPFQAQYREVRDIFKAFGELRSLRIPKKATTGEDAHRGFGFVDYMSK------ 838

  Fly   176 CEIHFHEINNKMVECKKAQPKEVMLPANLAKTRAAGRSAYGELVV-WGSSHAHS--------TAA 231
                        .|.|:|      ..|..|.|...||    .||: |.::..:.        |||
  Fly   839 ------------AEAKRA------FDALSASTHLYGR----RLVLEWSANDDNQDVEELRKRTAA 881

  Fly   232 -----TSAAAAGLLPSSLAAAASVLQQQQQQQQQQQQ 263
                 .:|.||.....|.......:|..|...::::|
  Fly   882 KFDGSQAATAAKRSRKSFFDVEGSVQPNQDDDEEEEQ 918

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 24/92 (26%)
RRM2_MSI 119..192 CDD:240769 17/74 (23%)
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796 52/218 (24%)
RRM5_RBM19_like 679..760 CDD:240764 24/81 (30%)
RRM6_RBM19 785..864 CDD:241015 27/107 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463989
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.