DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and TBPH

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster


Alignment Length:271 Identity:67/271 - (24%)
Similarity:104/271 - (38%) Gaps:72/271 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 MFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELD 95
            :.:.||.|:|:.||||:||..||::..|.:.||..:.:|:|||||.|...::..:||| ..|.:|
  Fly   109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLT-NRHLID 172

  Fly    96 GKKVDPKVAFPRRAHPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRG 160
            |:..:.||...:....::..   |:|||..:.....:|::.||.:||.:.|..:     ....|.
  Fly   173 GRWCEVKVP
NSKGMGHQVPC---KVFVGRCTEDINSDDLREYFSKFGEVTDVFI-----PRPFRA 229

  Fly   161 FGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLPANLAKTRAAGRSAYGELVVWGSSH 225
            |.||||...||...:|. ..|.|....|....|.||                             
  Fly   230 FSFVTFLDPDVAQSLCG-EDHIIKGVSVHVSNAAPK----------------------------- 264

  Fly   226 AHSTAATSAAAAGLLPSSLAAAASVLQQQQQQQQQQQQQQQQQQQHHQQLHHTHPQ----SPAHS 286
                                        .:|.:.||.|.......:...:|..|||    :|.. 
  Fly   265 ----------------------------AEQNRNQQVQSYNYNSANSFGMHSYHPQGNHMNPGR- 300

  Fly   287 HAHHPHTHSHS 297
            :.||...:.|:
  Fly   301 NGHHRGNNQHN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 30/73 (41%)
RRM2_MSI 119..192 CDD:240769 22/72 (31%)
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 29/72 (40%)
RRM2_TDP43 192..261 CDD:409761 22/77 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.