DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and TBPH

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001163280.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster


Alignment Length:271 Identity:67/271 - (24%)
Similarity:104/271 - (38%) Gaps:72/271 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 MFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELD 95
            :.:.||.|:|:.||||:||..||::..|.:.||..:.:|:|||||.|...::..:||| ..|.:|
  Fly   109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLT-NRHLID 172

  Fly    96 GKKVDPKVAFPRRAHPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRG 160
            |:..:.||...:....::..   |:|||..:.....:|::.||.:||.:.|..:     ....|.
  Fly   173 GRWCEVKVPNSKGMGHQVPC---KVFVGRCTEDINSDDLREYFSKFGEVTDVFI-----PRPFRA 229

  Fly   161 FGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLPANLAKTRAAGRSAYGELVVWGSSH 225
            |.||||...||...:|. ..|.|....|....|.||                             
  Fly   230 FSFVTFLDPDVAQSLCG-EDHIIKGVSVHVSNAAPK----------------------------- 264

  Fly   226 AHSTAATSAAAAGLLPSSLAAAASVLQQQQQQQQQQQQQQQQQQQHHQQLHHTHPQ----SPAHS 286
                                        .:|.:.||.|.......:...:|..|||    :|.. 
  Fly   265 ----------------------------AEQNRNQQVQSYNYNSANSFGMHSYHPQGNHMNPGR- 300

  Fly   287 HAHHPHTHSHS 297
            :.||...:.|:
  Fly   301 NGHHRGNNQHN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 30/73 (41%)
RRM2_MSI 119..192 CDD:240769 22/72 (31%)
TBPHNP_001163280.1 RRM1_TDP43 108..184 CDD:240767 30/75 (40%)
RRM2_TDP43 192..261 CDD:240768 22/77 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.