DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and Dazap1

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:XP_006241030.1 Gene:Dazap1 / 362836 RGDID:1305280 Length:406 Species:Rattus norvegicus


Alignment Length:216 Identity:85/216 - (39%)
Similarity:128/216 - (59%) Gaps:24/216 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHE 93
            ||:|:|||.|.|:.|:||.||.:||::.:.::|||.||.:|||||||.|.|||.|..||....|.
  Rat    10 GKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHT 74

  Fly    94 LDGKKVDPKVAFPRRAHPKMV--------------TRTKKIFVGGLSAPTTLEDVKSYFEQFGPI 144
            |||:.:|||...||...|:..              :::.||||||:.......:::.||::||.:
  Rat    75 LDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDSSKSNKIFVGGIPHNCGETELREYFKKFGVV 139

  Fly   145 EDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLPANLAKTRA 209
            .:.::::|.:..|.|||||:||:.|..||:...:|||:|..|.||.|:|:|::       :|.:|
  Rat   140 TEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRD-------SKNQA 197

  Fly   210 AGRSAYGELVVWGSSHAHSTA 230
            .|:....:   |||..|.|.|
  Rat   198 PGQPGASQ---WGSRVAPSAA 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 39/73 (53%)
RRM2_MSI 119..192 CDD:240769 29/72 (40%)
Dazap1XP_006241030.1 RRM1_DAZAP1 11..92 CDD:409988 42/80 (53%)
RRM2_DAZAP1 111..190 CDD:409765 31/78 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565323at2759
OrthoFinder 1 1.000 - - FOG0000417
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X310
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.