DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and Secp43

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster


Alignment Length:348 Identity:74/348 - (21%)
Similarity:131/348 - (37%) Gaps:76/348 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KMFIGGLSWQTSPESLRDYFGRYG-DISEAMVMKDPTTRRSRGFGFVTF-SDPNSVDKVLTQGTH 92
            ::::|.|....:...:...|.:.| |.:...:|::..|....|:.||.| ||.:::|.:     |
  Fly     7 QLWMGSLESYMTENFIIAAFRKMGEDPTTVRLMRNKYTGEPAGYCFVNFISDDHALDAM-----H 66

  Fly    93 ELDGKKV---DPKVAFPRRAHPKMV-----TRTKKIFVGGLSAPTTLED---VKSYFEQFGPIED 146
            :|:||.:   :|.|.|...:.....     .|...::||.||  :.::|   .|.:..:|..|:.
  Fly    67 KLNGKPIPGTNPIVRFRLNSASNSYKLPGNEREFSVWVGDLS--SDVDDYQLYKVFSSKFTSIKT 129

  Fly   147 AMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEIN------NKMVECKKAQPKEVMLPANLA 205
            |.::.| .....:|:|||.|..||.....    .:::|      .|.::...|.||.   .:.|.
  Fly   130 AKVILD-SLGFSKGYGFVRFGIEDEQKSA----LYDMNGYIGLGTKPIKICNAVPKP---KSELG 186

  Fly   206 KTRAAGRSAYGELVVWGSSHAHSTAATSAAAAGLLPSSLAAAASVLQQQQQQQQQQQQQQQQQQQ 270
            .....|.:.||    :||                  ...||..:...|.........|..|..|.
  Fly   187 GAVGEGNTNYG----YGS------------------GMTAAGGTDYSQYYDPTSTYWQGYQAWQG 229

  Fly   271 HHQQLHHTHPQSPAHSHAHHPHTHSHSQLLGSLRYTPYPLPAHLSAAAVVVAQQQHHHQQQQQQQ 335
            :::|...:...:.|:.......:||:          |..|..|..|.:.          |:..|.
  Fly   230 YYEQAGASITDAAAYYQQAMSQSHSN----------PQTLAQHAEAWSA----------QRSAQY 274

  Fly   336 QQQQQQQVVAAQQQHQQQQSLAQ 358
            :||||||..:|....:.:..|.:
  Fly   275 EQQQQQQTASAANGAEDENGLVE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 20/78 (26%)
RRM2_MSI 119..192 CDD:240769 19/81 (23%)
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 21/87 (24%)
RRM2_SECp43 99..180 CDD:241056 20/87 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463923
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.