DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and srsf2b

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_955945.2 Gene:srsf2b / 323700 ZFINID:ZDB-GENE-030131-2420 Length:220 Species:Danio rerio


Alignment Length:80 Identity:26/80 - (32%)
Similarity:43/80 - (53%) Gaps:3/80 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVL-TQGTHELDG 96
            :..|:::||||:||..|.:||.:.:..:.:|..|:.||||.||.|.|....:..: ......|||
Zfish    18 VDNLTYRTSPETLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAILDG 82

  Fly    97 KKVDPKVAFPRRAHP 111
            :::  :|...|...|
Zfish    83 REL--RVQMARYGRP 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 24/72 (33%)
RRM2_MSI 119..192 CDD:240769
srsf2bNP_955945.2 RRM_SRSF2_SRSF8 16..88 CDD:409751 23/71 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.