DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and hnrnpaba

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_997752.2 Gene:hnrnpaba / 321466 ZFINID:ZDB-GENE-030131-185 Length:340 Species:Danio rerio


Alignment Length:214 Identity:89/214 - (41%)
Similarity:122/214 - (57%) Gaps:18/214 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GPCSPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPN 81
            |....|:...|.||||:|||||.||.:.|:|||.::|::::..:..||.|.|||||||:.|.:|:
Zfish    57 GQIDASKGEEDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDPNTGRSRGFGFILFKEPS 121

  Fly    82 SVDKVLTQGTHELDGKKVDPKVAFPRRAHPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIED 146
            .|||||.|..|.|||:::|||.|...:..|     .||||||||:..||.|.::.||..||.||.
Zfish   122 GVDKVLAQKEHRLDGRQIDPKKAMAMKKEP-----VKKIFVGGLNPETTEERIREYFGAFGEIET 181

  Fly   147 AMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNK--------MVECKKAQPKEVMLPAN 203
            ..|..|.::|:.|||.|:||:.|:.|.|:.|..:|.::..        :.|.|.||||||.....
Zfish   182 IELPMDPKSNKRRGFVFITFKEEEAVKKILEKKYHNVSGTKDTSGKEGLCEIKIAQPKEVYQQQQ 246

  Fly   204 LAKT-----RAAGRSAYGE 217
            ....     |..||...|:
Zfish   247 YGGRFGGGGRGRGRGGQGQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 39/73 (53%)
RRM2_MSI 119..192 CDD:240769 31/80 (39%)
hnrnpabaNP_997752.2 CBFNT 1..69 CDD:285369 3/11 (27%)
RRM1_hnRNPAB 70..144 CDD:241201 40/73 (55%)
RRM2_hnRNPAB 149..228 CDD:241028 32/83 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.