Sequence 1: | NP_001097631.1 | Gene: | Rbp6 / 39919 | FlyBaseID: | FBgn0260943 | Length: | 499 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997752.2 | Gene: | hnrnpaba / 321466 | ZFINID: | ZDB-GENE-030131-185 | Length: | 340 | Species: | Danio rerio |
Alignment Length: | 214 | Identity: | 89/214 - (41%) |
---|---|---|---|
Similarity: | 122/214 - (57%) | Gaps: | 18/214 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 GPCSPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPN 81
Fly 82 SVDKVLTQGTHELDGKKVDPKVAFPRRAHPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIED 146
Fly 147 AMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNK--------MVECKKAQPKEVMLPAN 203
Fly 204 LAKT-----RAAGRSAYGE 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rbp6 | NP_001097631.1 | RRM1_MSI | 31..105 | CDD:241020 | 39/73 (53%) |
RRM2_MSI | 119..192 | CDD:240769 | 31/80 (39%) | ||
hnrnpaba | NP_997752.2 | CBFNT | 1..69 | CDD:285369 | 3/11 (27%) |
RRM1_hnRNPAB | 70..144 | CDD:241201 | 40/73 (55%) | ||
RRM2_hnRNPAB | 149..228 | CDD:241028 | 32/83 (39%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |