DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and HNRNPAB

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_112556.2 Gene:HNRNPAB / 3182 HGNCID:5034 Length:332 Species:Homo sapiens


Alignment Length:188 Identity:87/188 - (46%)
Similarity:114/188 - (60%) Gaps:5/188 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QQQVELGPCSPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFV 75
            |...|....:.|:...|.||||:|||||.||.:.|:|||.::|::.:..:..||.|.|||||||:
Human    52 QNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFI 116

  Fly    76 TFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRRAHPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQ 140
            .|.|..||:|||.|..|.|||:.:|||.|...:..|     .||||||||:...|.|.::.||.:
Human   117 LFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDP-----VKKIFVGGLNPEATEEKIREYFGE 176

  Fly   141 FGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEV 198
            ||.||...|..|.:.|:.|||.|:||:.|:.|.||.|..||.::....|.|.||||||
Human   177 FGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKEV 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 39/73 (53%)
RRM2_MSI 119..192 CDD:240769 32/72 (44%)
HNRNPABNP_112556.2 CBFNT 1..70 CDD:311868 4/17 (24%)
RRM1_hnRNPAB 66..145 CDD:410151 42/78 (54%)
RRM2_hnRNPAB 150..229 CDD:409997 35/83 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.