DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and HNRNPAB

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_112556.2 Gene:HNRNPAB / 3182 HGNCID:5034 Length:332 Species:Homo sapiens


Alignment Length:144 Identity:30/144 - (20%)
Similarity:52/144 - (36%) Gaps:43/144 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RKLRGLIAEKNCAPIMVRLA-WHSAGTFDCQSRTGGPFGTMRFD------AEQAHGANS------ 72
            ::|:.|:.|....|..::.| ...|.::..|.:   ....:..|      |||..|:.|      
Human   225 QELKALLLEAQKGPASLQEAIREQASSYSLQQK---DLQDLMMDLRGLVHAEQGQGSGSPTGSST 286

  Fly    73 ------GIHIALR-----------LLDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGRE 120
                  |:...::           .|:.:|||...:. ....|:|||:.:     ...|.|||..
Human   287 RGKDIDGLSATMKEQLRHSRQVYSCLEGLREQLDGLE-KTCSQMAGVLQL-----AQAPAHPGTV 345

  Fly   121 DKPQPPPEGRLPDA 134
            .    |.:|.||.:
Human   346 G----PVDGALPSS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 19/104 (18%)
RRM2_MSI 119..192 CDD:240769 4/16 (25%)
HNRNPABNP_112556.2 CBFNT 1..70 CDD:311868
RRM1_hnRNPAB 66..145 CDD:410151
RRM2_hnRNPAB 150..229 CDD:409997 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.