DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and gar2

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_593531.1 Gene:gar2 / 2542869 PomBaseID:SPAC140.02 Length:500 Species:Schizosaccharomyces pombe


Alignment Length:207 Identity:62/207 - (29%)
Similarity:100/207 - (48%) Gaps:16/207 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KIEQQQQQQQVELGPCSPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRR 68
            |.|...:::..::  ..||:..|:...:|:|.|||....:.|...|..||.|..|.|:.|..:.|
pombe   240 KAEPASEERPAKI--TKPSQDSNETCTVFVGRLSWNVDDQWLGQEFEEYGTIVGARVIMDGQSGR 302

  Fly    69 SRGFGFVTFSDPNSVD-KVLTQGTHELDGKKVDPKVAFPRRAHPKMVTRTK-------------K 119
            |:|:|:|.|..|.:.. .|...||.|:||:.|:..::.||.|:|:...:.:             .
pombe   303 SKGYGYVDFETPEAAKAAVAANGTKEIDGRMVNLDLSNPRPANPQPYAQQRAGNFGDQLSEPSDT 367

  Fly   120 IFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEIN 184
            :|||.||...|.:|:.:.|...|.|:...|..|.|:.|.:|||:|||...|...|..|::.|.|.
pombe   368 VFVGNLSFNATEDDLSTAFGGCGDIQSIRLPTDPQSGRLKGFGYVTFSDIDSAKKCVEMNGHFIA 432

  Fly   185 NKMVECKKAQPK 196
            .:......:.|:
pombe   433 GRPCRLDFSTPR 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 27/74 (36%)
RRM2_MSI 119..192 CDD:240769 25/72 (35%)
gar2NP_593531.1 RRM1_gar2 264..339 CDD:240893 27/74 (36%)
RRM2_gar2 368..439 CDD:240894 25/70 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I1542
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.