DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and RBM24

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001137414.1 Gene:RBM24 / 221662 HGNCID:21539 Length:236 Species:Homo sapiens


Alignment Length:343 Identity:80/343 - (23%)
Similarity:111/343 - (32%) Gaps:121/343 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 TRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIH 179
            |...|||||||...||...::.|||.||.||:|:::.|:||.:.||:||||.......::.|   
Human     8 TTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERAC--- 69

  Fly   180 FHEINNKMVECKKAQPKEVMLPANLAKTRAAGRSAYGELVVWGSSHAHSTAATSAAAAGLLPSSL 244
              :..|.:::.:||.       .|||                                     .|
Human    70 --KDPNPIIDGRKAN-------VNLA-------------------------------------YL 88

  Fly   245 AAAASVLQQQQQQQQQQQQQQQQQQQHHQQLHHTHPQSPAHSHAHHPHTHSHSQLLGSLRYTPYP 309
            .|...::|.......||......|:......|:.:||:........||....:....:..|..|.
Human    89 GAKPRIMQPGFAFGVQQLHPALIQRPFGIPAHYVYPQAFVQPGVVIPHVQPTAAAASTTPYIDYT 153

  Fly   310 LPAHLSAAAVVVAQQQHHHQQQQQQQQQQQQQQVVAAQQQHQQQQSLAQVVAAAAGAAPGLLPLA 374
            ..|:                                           ||..||||.||       
Human   154 GAAY-------------------------------------------AQYSAAAAAAA------- 168

  Fly   375 NPAPPATPSLLQFAAGQSNAALANSLYADAAAVVGYKRLLAAAAVSSGLRAPTTAL--GALQAAA 437
                             :.||.....||.:.|..||   :.|......::.|.||.  |...|||
Human   169 -----------------AAAAYDQYPYAASPAAAGY---VTAGGYGYAVQQPITAAAPGTAAAAA 213

  Fly   438 ANVPAAAAAAQLQQAQLR 455
            |...||||..|.|..||:
Human   214 AAAAAAAAFGQYQPQQLQ 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020
RRM2_MSI 119..192 CDD:240769 28/72 (39%)
RBM24NP_001137414.1 RRM_RBM24_RBM38_like 11..86 CDD:409818 31/86 (36%)
Necessary for interaction with EIF4E. /evidence=ECO:0000269|PubMed:29358667 175..199 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.