DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and HNRNPA3

DIOPT Version :9

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001317178.1 Gene:HNRNPA3 / 220988 HGNCID:24941 Length:378 Species:Homo sapiens


Alignment Length:193 Identity:82/193 - (42%)
Similarity:117/193 - (60%) Gaps:3/193 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDK 85
            |.| |....|:||||||::|:.:|||::|.::|.:::.:||:||.|:|||||||||:|....||.
Human    28 PKE-PEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDA 91

  Fly    86 VLTQGTHELDGKKVDPKVAFPRR--AHPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAM 148
            .:....|::||:.|:||.|..|.  ..|......|||||||:...|...:::.|||::|.||...
Human    92 AMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIE 156

  Fly   149 LMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLPANLAKTRAAG 211
            :|.|:|:.:.|||.||||...|.|||:....:|.||....|.|||..|:.|..|...:.|..|
Human   157 VMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 35/73 (48%)
RRM2_MSI 119..192 CDD:240769 31/72 (43%)
HNRNPA3NP_001317178.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 3/7 (43%)
RRM1_hnRNPA_like 36..113 CDD:409992 37/76 (49%)
RRM2_hnRNPA3 126..205 CDD:409996 35/78 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..225 5/16 (31%)
HnRNPA1 331..>347 CDD:402981
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 336..378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1869
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.