DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and Rbm3

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_058089.2 Gene:Rbm3 / 19652 MGIID:1099460 Length:154 Species:Mus musculus


Alignment Length:75 Identity:32/75 - (42%)
Similarity:54/75 - (72%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDP-NSVDKVLTQ 89
            ::.||:|:|||::.|..::|.|:|..:|.|||.:|:||..|:|||||||:||::| ::.|.:...
Mouse     3 SEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDAMRAM 67

  Fly    90 GTHELDGKKV 99
            ....|||:::
Mouse    68 NGESLDGRQI 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 31/71 (44%)
RRM2_MSI 119..192 CDD:240769
Rbm3NP_058089.2 RRM_CIRBP_RBM3 6..85 CDD:409883 32/72 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.