DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and Ncl

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_035010.3 Gene:Ncl / 17975 MGIID:97286 Length:707 Species:Mus musculus


Alignment Length:222 Identity:59/222 - (26%)
Similarity:94/222 - (42%) Gaps:41/222 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QQQQQQVELGPCSPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTT--RRSR 70
            ::.|:|...|  ..|....:...:.:..||:..:.|:|.:.|      .:|..:|.|..  .:.:
Mouse   468 EKGQRQERTG--KTSTWSGESKTLVLSNLSYSATKETLEEVF------EKATFIKVPQNPHGKPK 524

  Fly    71 GFGFVTFSD-------PNSVDKVLTQGTH---ELDGKKVDPKVAFPRRAHPKMVTRTKKIFVGGL 125
            |:.|:.|:.       .||.:|:..:|..   ||.|..        .|:.|     :|.:||.||
Mouse   525 GYAFIEFASFEDAKEALNSCNKMEIEGRTIRLELQGSN--------SRSQP-----SKTLFVKGL 576

  Fly   126 SAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCE-IHFHEINNKMVE 189
            |..||.|.:|..||  |.:. |.::.|::|...:|||||.|.||:......| :...||:...|.
Mouse   577 SEDTTEETLKESFE--GSVR-ARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVT 638

  Fly   190 CKKAQPKEVMLPANLAKTRAAGRSAYG 216
            ...|:||    .......|..||..:|
Mouse   639 LDWAKPK----GEGGFGGRGGGRGGFG 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 18/86 (21%)
RRM2_MSI 119..192 CDD:240769 27/73 (37%)
NclNP_035010.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..308
PRK13808 <12..142 CDD:172341
8 X 8 AA tandem repeats of X-T-P-X-K-K-X-X 58..135
RRM1_NCL 309..383 CDD:409837
RRM2_NCL 392..467 CDD:409838
RRM3_NCL 486..558 CDD:409839 15/77 (19%)
RRM4_NCL 569..646 CDD:409840 31/83 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..707 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.