DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and hrpa-1

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001040945.1 Gene:hrpa-1 / 177101 WormBaseID:WBGene00001999 Length:347 Species:Caenorhabditis elegans


Alignment Length:168 Identity:32/168 - (19%)
Similarity:54/168 - (32%) Gaps:63/168 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 EGRLPDATKGCDH---------LRDV--------FAKQMGLSDKDIVALSGAHTLGRCHKDRSGF 175
            :|...:..|||.|         |:|:        |..::     ::::|:....|.|.:    ||
 Worm   320 KGGFGNVYKGCLHDGSIIAVKRLKDINNGGGEVQFQTEL-----EMISLAVHRNLLRLY----GF 375

  Fly   176 EGAWTSNPLIFDNSYF--------------------KELLSGEKEGLLQL------------VSD 208
              ..||:..:....|.                    |.:..|...|||.|            |..
 Worm   376 --CTTSSERLLVYPYMSNGSVASRLKAKPVLDWGTRKRIALGAGRGLLYLHEQCDPKIIHRDVKA 438

  Fly   209 KALLDDPVFRPLVEKYAADEDAFFADYAEAHMKLSELG 246
            ..:|.|..|..:|..:..   |...|:.|:|:..:..|
 Worm   439 ANILLDDYFEAVVGDFGL---AKLLDHEESHVTTAVRG 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990
RRM2_MSI 119..192 CDD:240769 16/100 (16%)
hrpa-1NP_001040945.1 RRM_SF 24..101 CDD:473069
RRM2_hnRNPA_like 115..187 CDD:409766
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.