DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and rsp-1

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_496442.1 Gene:rsp-1 / 174748 WormBaseID:WBGene00004698 Length:312 Species:Caenorhabditis elegans


Alignment Length:101 Identity:28/101 - (27%)
Similarity:49/101 - (48%) Gaps:23/101 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 KIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSE-DVVDKVCEIHFHE 182
            :|::|.|::..:.:|::.:|..:|.|.|.:|        ..|||||.|..: |..|.|     |:
 Worm     4 RIYIGRLTSRVSEKDIEHFFRGYGQIRDVLL--------KNGFGFVEFDDKRDAEDAV-----HD 55

  Fly   183 INNKMVECKKAQPKEVMLPANLAKTRAAG--RSAYG 216
            :|.     |:...:.|:|  :.:|.|..|  |..:|
 Worm    56 LNG-----KELGGERVIL--DYSKPRGGGGDRGGFG 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990
RRM2_MSI 119..192 CDD:240769 20/73 (27%)
rsp-1NP_496442.1 RRM1_SRSF4_like 4..73 CDD:409774 23/88 (26%)
RRM2_SRSF1_4_like 129..198 CDD:409776
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.