DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp6 and tdp-1

DIOPT Version :10

Sequence 1:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001254189.1 Gene:tdp-1 / 174436 WormBaseID:WBGene00006514 Length:414 Species:Caenorhabditis elegans


Alignment Length:202 Identity:55/202 - (27%)
Similarity:84/202 - (41%) Gaps:13/202 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVL 87
            |..:.|..:.:.|:.::|:.|..:.||...|.:....: |..:...|:|||||..|.....:|||
 Worm   167 ERDSQPVDLIVLGVDFKTTDECFQKYFEDIGTVVFCEI-KRKSDGNSKGFGFVRMSSVGEQNKVL 230

  Fly    88 TQGTHELDGKKVDPKVAFPRRAHPKMVTRT-KKIFVGGLSAPTTLEDVKSYF--EQFGPIEDAML 149
            ....|.:||::.|.||...|....|....: .:||||.|:.......::..|  |....||.|::
 Worm   231 AIPQHMIDGRRCDVKVPDGRSLQDKQGRPSISRIFVGRLTDKVDEHQLRKVFGDEAKSYIETAVV 295

  Fly   150 MFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKE---------VMLPANLA 205
            .........|||.|||..|.:..:::.......:|...|....|||:|         ..|||...
 Worm   296 TDVFIPKPFRGFAFVTLSSAEAAERIVSKGSLTVNGLSVGLSIAQPREENNQSVGPDYGLPAGYR 360

  Fly   206 KTRAAGR 212
            ..|...|
 Worm   361 NRRERDR 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 23/74 (31%)
RRM2_MSI 119..192 CDD:240769 19/74 (26%)
tdp-1NP_001254189.1 TDP43_N 47..121 CDD:465833
RRM_SF 174..247 CDD:473069 22/73 (30%)
RRM_SF 262..339 CDD:473069 19/76 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.